(data stored in ACNUC7421 zone)

EMBL: CP001022.PE442

CP001022.PE442       Location/Qualifiers
FT   CDS             474968..476071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0448"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: bcz:BCZK0264 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59930"
FT                   /db_xref="GOA:B1YJ00"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ00"
FT                   /protein_id="ACB59930.1"
FT                   /translation="MKRVGILGGGQLGRMMALSARQMGYSLITLDPTENAPCAQVADQQ
FT                   IQAPFTDVEAAKRLAAESDVVTYEFENISHEVAEAIGYKLIHGTELLFRTQHRIREKEL
FT                   IEQLGYKVAPYQGVQTSEDLLGAKRQLGFPFVLKTARFGYDGKGQTVIRTELDLQTAMK
FT                   TFEATEYVAEKWLPFDQEISVIVMRSERETKVFPVSENIHQDNILHLSIVPARIPIDLE
FT                   QKAIELATRLANDVDLIGTLAIELFVVGSELIVNELAPRPHNSGHYSIDACETSQFEQH
FT                   IRAICGLPLGDTRLTTPVVMANILGQHITALDEALPMLSSRTKVHLYGKQDAKQGRKMG
FT                   HLNILADSVEEALAEVERLQIWKETVR"
     MKRVGILGGG QLGRMMALSA RQMGYSLITL DPTENAPCAQ VADQQIQAPF TDVEAAKRLA        60
     AESDVVTYEF ENISHEVAEA IGYKLIHGTE LLFRTQHRIR EKELIEQLGY KVAPYQGVQT       120
     SEDLLGAKRQ LGFPFVLKTA RFGYDGKGQT VIRTELDLQT AMKTFEATEY VAEKWLPFDQ       180
     EISVIVMRSE RETKVFPVSE NIHQDNILHL SIVPARIPID LEQKAIELAT RLANDVDLIG       240
     TLAIELFVVG SELIVNELAP RPHNSGHYSI DACETSQFEQ HIRAICGLPL GDTRLTTPVV       300
     MANILGQHIT ALDEALPMLS SRTKVHLYGK QDAKQGRKMG HLNILADSVE EALAEVERLQ       360
     IWKETVR                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page