(data stored in ACNUC7421 zone)

EMBL: CP001022.PE445

CP001022.PE445       Location/Qualifiers
FT   CDS             478128..478376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0451"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: bca:BCE_0321 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59933"
FT                   /db_xref="GOA:B1YJ03"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ03"
FT                   /protein_id="ACB59933.1"
FT                   /translation="MKKVTVAVALRESILDPQGVAVKGGLVQLGFAGVEEVRIGKRIEL
FT                   LVADETTDAMIHEMCQKLLVNTVMEDYRFDVEEVTTA"
     MKKVTVAVAL RESILDPQGV AVKGGLVQLG FAGVEEVRIG KRIELLVADE TTDAMIHEMC        60
     QKLLVNTVME DYRFDVEEVT TA                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page