(data stored in ACNUC7421 zone)

EMBL: CP001022.PE449

CP001022.PE449       Location/Qualifiers
FT   CDS             482661..483695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0455"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: bha:BH0631 phosphoribosylaminoimidazole
FT                   synthetase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59937"
FT                   /db_xref="GOA:B1YJ07"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ07"
FT                   /protein_id="ACB59937.1"
FT                   /translation="MSKQYEAAGVSLTAGYESVSRMKKHVARSMRKEVMTGLGSFGAMF
FT                   DLSQLNLKEPVLVSGTDGVGTKLKLAFALDQHDTIGIDCVAMCVNDIIVQGAEPLYFLD
FT                   YIALGKAIPAKIERIVAGVAEGCVQSGCTLIGGETAEMPGMYADGEYDIAGFAVGAVEK
FT                   QKLITGEHVQPGDVILGLASSGVHSNGFSLVRKIVAESGLRYEDELMMFGSTIGNTLLM
FT                   PTRIYVEAVKAALETEKIQAMVHITGGGFYENVPRVLPEGCGATFDPKKWPTLPVFDWL
FT                   EQAGNVPRHDMYNVFNMGIGYMMIVKPEDVAAVSARLARENETVYTIGTVTSEPGVRIL
FT                   GVDQ"
     MSKQYEAAGV SLTAGYESVS RMKKHVARSM RKEVMTGLGS FGAMFDLSQL NLKEPVLVSG        60
     TDGVGTKLKL AFALDQHDTI GIDCVAMCVN DIIVQGAEPL YFLDYIALGK AIPAKIERIV       120
     AGVAEGCVQS GCTLIGGETA EMPGMYADGE YDIAGFAVGA VEKQKLITGE HVQPGDVILG       180
     LASSGVHSNG FSLVRKIVAE SGLRYEDELM MFGSTIGNTL LMPTRIYVEA VKAALETEKI       240
     QAMVHITGGG FYENVPRVLP EGCGATFDPK KWPTLPVFDW LEQAGNVPRH DMYNVFNMGI       300
     GYMMIVKPED VAAVSARLAR ENETVYTIGT VTSEPGVRIL GVDQ                        344
//

If you have problems or comments...

PBIL Back to PBIL home page