(data stored in ACNUC7421 zone)

EMBL: CP001022.PE450

CP001022.PE450       Location/Qualifiers
FT   CDS             483692..484267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0456"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: bcy:Bcer98_0276 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59938"
FT                   /db_xref="GOA:B1YJ08"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ08"
FT                   /protein_id="ACB59938.1"
FT                   /translation="MKIACFASGSGSNVEALFEAVETGRLQATIELVVCDQKQAKVIER
FT                   AQARGCDIFVFTAKDYPDKPSFEREIVAELERRGVERIILAGYMRLIGDVLLSHYAGRI
FT                   VNIHPSLLPAFPGKDAIGQAFRGGVKITGVTIHIVDEGMDTGPIIAQEAVRITEDMTRE
FT                   TLQQAIQQVEHRLYPQVIEEWMKEEANV"
     MKIACFASGS GSNVEALFEA VETGRLQATI ELVVCDQKQA KVIERAQARG CDIFVFTAKD        60
     YPDKPSFERE IVAELERRGV ERIILAGYMR LIGDVLLSHY AGRIVNIHPS LLPAFPGKDA       120
     IGQAFRGGVK ITGVTIHIVD EGMDTGPIIA QEAVRITEDM TRETLQQAIQ QVEHRLYPQV       180
     IEEWMKEEAN V                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page