(data stored in ACNUC7421 zone)

EMBL: CP001022.PE456

CP001022.PE456       Location/Qualifiers
FT   CDS             490830..491054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59944"
FT                   /db_xref="GOA:B1YJ14"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ14"
FT                   /protein_id="ACB59944.1"
FT                   /translation="MNRTFWINFGYIFMVPALPFLALVNGRALCSPDSPLLDIPVLGFF
FT                   LAEPWAFAVVYAFLAFGLATLLTKRRTRT"
     MNRTFWINFG YIFMVPALPF LALVNGRALC SPDSPLLDIP VLGFFLAEPW AFAVVYAFLA        60
     FGLATLLTKR RTRT                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page