(data stored in ACNUC7421 zone)

EMBL: CP001022.PE459

CP001022.PE459       Location/Qualifiers
FT   CDS             494107..496101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0465"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: bay:RBAM_007020 LigA; TIGRFAM: DNA ligase,
FT                   NAD-dependent; PFAM: helix-hairpin-helix motif; BRCT domain
FT                   protein; zinc-finger NAD-dependent DNA ligase C4-type;
FT                   NAD-dependent DNA ligase OB-fold; NAD-dependent DNA ligase
FT                   adenylation; SMART: Helix-hairpin-helix DNA-binding class
FT                   1; NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59947"
FT                   /db_xref="GOA:B1YJ17"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ17"
FT                   /protein_id="ACB59947.1"
FT                   /translation="MIEQARIEELRQKLNQYSYEYYVQDQPTVPDSTYDQLLRELTELE
FT                   TAHPELITPDSPTQRVGAAALDAFEKVTHDLPMLSLGNVFDETEIREWVARIERSLGRS
FT                   TTYVAELKFDGLAISLKYEDGQLVRGATRGDGTVGENITQNLRTIKALPLRLRRNETVE
FT                   VRGEAYMPKQSFERLNADRAAREEALFANPRNAAAGSLRQLDSSITASRNLSLFVYGVG
FT                   VNTLSARSHSEAMLQLAELGLPTNKEMQTCETVEEILAYIAHWTMERSNLPYEIDGIVL
FT                   KVDRYDDQEELGFTAKSPRFATAYKFAAEEVMTTVEEVDFSVGRTGKVTPRARFAPVVV
FT                   AGSTVSYATLHNADFITEKDIRLHDQVIIKKAGDVIPAVVSVVVSERTGNEQPIEFPAH
FT                   CPACESELVRLEGEADIRCVSPECPAQLVEGIIHFVSRQAMNIDGLGEKVVRQLYEHEA
FT                   IRTLADLYRLDRDELLTYERMGETSVDNLLTAIEASKQNSLERLMFGLGIRLVGQKAAY
FT                   LLAERFDSLDGIAQAEYEDILAIDGIGSKIADSVTKYFEHPEAQALIKDLAELGLNQQF
FT                   LGQRVDQSNAPLAGKTIVLTGTLESLKRSEAGKRLELLGADVTGSVSKKTDILVAGEKA
FT                   GSKLTKAESLGIEIWNETQLLEELAKYEG"
     MIEQARIEEL RQKLNQYSYE YYVQDQPTVP DSTYDQLLRE LTELETAHPE LITPDSPTQR        60
     VGAAALDAFE KVTHDLPMLS LGNVFDETEI REWVARIERS LGRSTTYVAE LKFDGLAISL       120
     KYEDGQLVRG ATRGDGTVGE NITQNLRTIK ALPLRLRRNE TVEVRGEAYM PKQSFERLNA       180
     DRAAREEALF ANPRNAAAGS LRQLDSSITA SRNLSLFVYG VGVNTLSARS HSEAMLQLAE       240
     LGLPTNKEMQ TCETVEEILA YIAHWTMERS NLPYEIDGIV LKVDRYDDQE ELGFTAKSPR       300
     FATAYKFAAE EVMTTVEEVD FSVGRTGKVT PRARFAPVVV AGSTVSYATL HNADFITEKD       360
     IRLHDQVIIK KAGDVIPAVV SVVVSERTGN EQPIEFPAHC PACESELVRL EGEADIRCVS       420
     PECPAQLVEG IIHFVSRQAM NIDGLGEKVV RQLYEHEAIR TLADLYRLDR DELLTYERMG       480
     ETSVDNLLTA IEASKQNSLE RLMFGLGIRL VGQKAAYLLA ERFDSLDGIA QAEYEDILAI       540
     DGIGSKIADS VTKYFEHPEA QALIKDLAEL GLNQQFLGQR VDQSNAPLAG KTIVLTGTLE       600
     SLKRSEAGKR LELLGADVTG SVSKKTDILV AGEKAGSKLT KAESLGIEIW NETQLLEELA       660
     KYEG                                                                    664
//

If you have problems or comments...

PBIL Back to PBIL home page