(data stored in ACNUC7421 zone)

EMBL: CP001022.PE460

CP001022.PE460       Location/Qualifiers
FT   CDS             complement(496191..496766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0466"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: cac:CAC0204 sortase (surface protein
FT                   transpeptidase), YhcS B.subtilis ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59948"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ18"
FT                   /protein_id="ACB59948.1"
FT                   /translation="MKRQKFLGLLLLIAGILLILWPLYTNHQKQAAAEELKQQWTQNLK
FT                   AVDAKETKQPVATNGSGLLTIPSLNFEQVILEGASTAVLDQSIGHLKATGAPGKGNYAL
FT                   AGHRSFTKGLHFNRLPELKTGAHVIVTTKSHRYTYQMKTSQLVKPTDLSVLNQDVKQAT
FT                   LTLITCDPPETATNRLIKQGVLIKTESL"
     MKRQKFLGLL LLIAGILLIL WPLYTNHQKQ AAAEELKQQW TQNLKAVDAK ETKQPVATNG        60
     SGLLTIPSLN FEQVILEGAS TAVLDQSIGH LKATGAPGKG NYALAGHRSF TKGLHFNRLP       120
     ELKTGAHVIV TTKSHRYTYQ MKTSQLVKPT DLSVLNQDVK QATLTLITCD PPETATNRLI       180
     KQGVLIKTES L                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page