(data stored in ACNUC7421 zone)

EMBL: CP001022.PE461

CP001022.PE461       Location/Qualifiers
FT   CDS             496899..498077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0467"
FT                   /product="CamS sex pheromone cAM373 family protein"
FT                   /note="PFAM: CamS sex pheromone cAM373 family protein;
FT                   KEGG: bay:RBAM_007030 YerH"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59949"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ19"
FT                   /protein_id="ACB59949.1"
FT                   /translation="MKSKKIAALTLTSTLFLGACSFDLSQKSDTKEVITESEQGKEVQA
FT                   VVSPAIDTTDSYYRTVLPFRPSVARGMTQKRVSSRLELDEIETGLMRHSTQFFAPDKYY
FT                   YQEGQLLEADQIAQWLLRKGKAVDGVSDPNGLNPAYTTGKSYKEKNQKSPLILSHILEQ
FT                   DYMLEEDKKLELGGTSVALVLNSEYVFQDENYGPTYTVKLDEKKVIAEGKRMANELVKK
FT                   MRKTDGIKTTPIHVALYLQESEGSPVSGHYVSSAFIGRGNQISSNDWKNYDEKYYYYPS
FT                   GAATNDVRDDAAKFDLFKDRLEDYFPNYTGMMGEGFYQEGELKKLEIKIPVQFYGKAEL
FT                   VAFIQYVTYLLENRWEYNRNVPTTITVTNLNGDTEAMLFIEPDTKKPIVKIR"
     MKSKKIAALT LTSTLFLGAC SFDLSQKSDT KEVITESEQG KEVQAVVSPA IDTTDSYYRT        60
     VLPFRPSVAR GMTQKRVSSR LELDEIETGL MRHSTQFFAP DKYYYQEGQL LEADQIAQWL       120
     LRKGKAVDGV SDPNGLNPAY TTGKSYKEKN QKSPLILSHI LEQDYMLEED KKLELGGTSV       180
     ALVLNSEYVF QDENYGPTYT VKLDEKKVIA EGKRMANELV KKMRKTDGIK TTPIHVALYL       240
     QESEGSPVSG HYVSSAFIGR GNQISSNDWK NYDEKYYYYP SGAATNDVRD DAAKFDLFKD       300
     RLEDYFPNYT GMMGEGFYQE GELKKLEIKI PVQFYGKAEL VAFIQYVTYL LENRWEYNRN       360
     VPTTITVTNL NGDTEAMLFI EPDTKKPIVK IR                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page