(data stored in ACNUC7421 zone)

EMBL: CP001022.PE483

CP001022.PE483       Location/Qualifiers
FT   CDS             522935..523642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0489"
FT                   /product="Tetrahydrodipicolinate succinyltransferase domain
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Tetrahydrodipicolinate succinyltransferase domain
FT                   protein; KEGG: cpf:CPF_2165 putative
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59971"
FT                   /db_xref="GOA:B1YJ41"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ41"
FT                   /protein_id="ACB59971.1"
FT                   /translation="MLLTDAYEIAKFIKDAKKQTPVKLYVNGDLAGLTIEGATAFGTDQ
FT                   SKIFFADAGLASTFLEEYADRITEVHVEYDRRNSAVPMLDTRHLNARIEPGSWIRDHVV
FT                   IGDNAVIMMGAIINIGASIGDGTMIDMNAVVGARGTIGKNVHVGAGAVVAGVLEPPSKT
FT                   PVIIEDGVLIGANAVILEGVRVGKDAVVAAGSVVTEDVPAGSVVAGTPARVIKQKDEKT
FT                   AEKTQLVDDLRSL"
     MLLTDAYEIA KFIKDAKKQT PVKLYVNGDL AGLTIEGATA FGTDQSKIFF ADAGLASTFL        60
     EEYADRITEV HVEYDRRNSA VPMLDTRHLN ARIEPGSWIR DHVVIGDNAV IMMGAIINIG       120
     ASIGDGTMID MNAVVGARGT IGKNVHVGAG AVVAGVLEPP SKTPVIIEDG VLIGANAVIL       180
     EGVRVGKDAV VAAGSVVTED VPAGSVVAGT PARVIKQKDE KTAEKTQLVD DLRSL            235
//

If you have problems or comments...

PBIL Back to PBIL home page