(data stored in ACNUC7421 zone)

EMBL: CP001022.PE484

CP001022.PE484       Location/Qualifiers
FT   CDS             523668..524600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0490"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: har:HEAR2611
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59972"
FT                   /db_xref="GOA:B1YJ42"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ42"
FT                   /protein_id="ACB59972.1"
FT                   /translation="MAVDTQYGEAIWLDGVFHDPKEANTSVMSHAIHYGSGFFEGIRAY
FT                   ATPDGPAIFQLTEHIERLFRSCAFYHVTIPYTVEELVQATIDLVAKNGFESCYIRPFVF
FT                   LGTPWQALMAKDTTVHVGISCWELGEYFDKGAGIRAKVASYRRVSSTMMPMQAKAAANY
FT                   MNSQLLKGEAQRDGFDEAIALDMNGNVSEASVANLFMLKNGTIYTPSLDCSVLDGITRQ
FT                   VIMRLAQDQGYPVVERHIGRDELYVADEIFLTGTAAEITSVGEIDHIVINGGTRTVADE
FT                   LLDLYRQTVSGQLPQYADWLTHVTPAVAE"
     MAVDTQYGEA IWLDGVFHDP KEANTSVMSH AIHYGSGFFE GIRAYATPDG PAIFQLTEHI        60
     ERLFRSCAFY HVTIPYTVEE LVQATIDLVA KNGFESCYIR PFVFLGTPWQ ALMAKDTTVH       120
     VGISCWELGE YFDKGAGIRA KVASYRRVSS TMMPMQAKAA ANYMNSQLLK GEAQRDGFDE       180
     AIALDMNGNV SEASVANLFM LKNGTIYTPS LDCSVLDGIT RQVIMRLAQD QGYPVVERHI       240
     GRDELYVADE IFLTGTAAEI TSVGEIDHIV INGGTRTVAD ELLDLYRQTV SGQLPQYADW       300
     LTHVTPAVAE                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page