(data stored in ACNUC7421 zone)

EMBL: CP001022.PE489

CP001022.PE489       Location/Qualifiers
FT   CDS             529387..530970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0495"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; Substrate-binding region of
FT                   ABC-type glycine betaine transport system; KEGG:
FT                   cbh:CLC_1663 glycine betaine/L-proline ABC transporter,
FT                   permease/glycine betaine/L-proline-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59977"
FT                   /db_xref="GOA:B1YJ47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ47"
FT                   /protein_id="ACB59977.1"
FT                   /translation="MNGFLDYVQNNTGQIFDLLLEHLQLTVLAVVIAVVLGIPIGILIT
FT                   RYQRFAKPILALTSVVQAVPSLALLGFLIPFIGIGSTPAIIMVVLYSLLPIVKNTYTGL
FT                   SSIPGDMLEAAKGIGLTDRQILGKVQIPLALPIMMAGIRISAVTAVGLMTISAFIGAGG
FT                   LGYLVFSGIQTVDNNQILAGAIPAGILALAIDFIVSRIEYSVAPNGIPLADGRVKSRAR
FT                   KRRKAMSAGKKIAIAAIVFLLIGGTVAYSFLKTDKIVIGSKNFTEQLILGNMLADLIED
FT                   KTDLEVERQLNLGGTKVAYGALETGEIDAYVEYTGTLLIDVLKQKLETDPEAVYKKVGK
FT                   MIPEKSQVDVLEPIGFNNTYALAMTKEDIKKYDLKTVSDMAGVSNRLILGSTIEFANRE
FT                   DGYLGLKEKYPDMKFKDVQPVDGGLRYTALTNGKTNVIDSFSTDGLLKKFDLTVLEDDK
FT                   EFFPPYYAVPIVRQETLEEHPELKEVLNLLKDKITDKKMQELNFKADVEKERPEDVARE
FT                   FLIEEELIKK"
     MNGFLDYVQN NTGQIFDLLL EHLQLTVLAV VIAVVLGIPI GILITRYQRF AKPILALTSV        60
     VQAVPSLALL GFLIPFIGIG STPAIIMVVL YSLLPIVKNT YTGLSSIPGD MLEAAKGIGL       120
     TDRQILGKVQ IPLALPIMMA GIRISAVTAV GLMTISAFIG AGGLGYLVFS GIQTVDNNQI       180
     LAGAIPAGIL ALAIDFIVSR IEYSVAPNGI PLADGRVKSR ARKRRKAMSA GKKIAIAAIV       240
     FLLIGGTVAY SFLKTDKIVI GSKNFTEQLI LGNMLADLIE DKTDLEVERQ LNLGGTKVAY       300
     GALETGEIDA YVEYTGTLLI DVLKQKLETD PEAVYKKVGK MIPEKSQVDV LEPIGFNNTY       360
     ALAMTKEDIK KYDLKTVSDM AGVSNRLILG STIEFANRED GYLGLKEKYP DMKFKDVQPV       420
     DGGLRYTALT NGKTNVIDSF STDGLLKKFD LTVLEDDKEF FPPYYAVPIV RQETLEEHPE       480
     LKEVLNLLKD KITDKKMQEL NFKADVEKER PEDVAREFLI EEELIKK                     527
//

If you have problems or comments...

PBIL Back to PBIL home page