(data stored in ACNUC7421 zone)

EMBL: CP001022.PE49

CP001022.PE49        Location/Qualifiers
FT   CDS             67613..68857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0050"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: efa:EF0263 tRNA(Ile)-lysidine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59537"
FT                   /db_xref="GOA:B1YGQ4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGQ4"
FT                   /protein_id="ACB59537.1"
FT                   /translation="MEFEIHLPKEPLLVAVSGGCDSMVLAHLLYEANHDLMIVHVHHGL
FT                   RKESDEEAEAVRAWAEARRVGIRMTRLEWEGQAPSQAACRTRRYAFFQEVMAETGRRHL
FT                   VLAHHRDDQLETLLIQLIRGEAGVDGIPRIRSFATGQIHRPLLPYSKQQLYDYAKARQV
FT                   VWHEDETNAGTKYLRNQMRHRLLPLLAELRPGYEEATVQAAMVRYEQKQEHLKYVTSYV
FT                   KEQMTDRGLPLEAIQKLPTDFRRLVLRALLPDHDFTSEDYNRFLTLLRVDMPSGEVYYG
FT                   NWRIQRTYGYVTCVRCPEKNLLPEALEVGIDLGTYHYGEQTITFSRTTTGIPFSAVQFP
FT                   LTIRSVLPGDRIRLAVGTKKVSRILVDAKVPRASRAEIPVVVDAAGQVLAVIGHRIAIF
FT                   GSFELLAESCLMIEW"
     MEFEIHLPKE PLLVAVSGGC DSMVLAHLLY EANHDLMIVH VHHGLRKESD EEAEAVRAWA        60
     EARRVGIRMT RLEWEGQAPS QAACRTRRYA FFQEVMAETG RRHLVLAHHR DDQLETLLIQ       120
     LIRGEAGVDG IPRIRSFATG QIHRPLLPYS KQQLYDYAKA RQVVWHEDET NAGTKYLRNQ       180
     MRHRLLPLLA ELRPGYEEAT VQAAMVRYEQ KQEHLKYVTS YVKEQMTDRG LPLEAIQKLP       240
     TDFRRLVLRA LLPDHDFTSE DYNRFLTLLR VDMPSGEVYY GNWRIQRTYG YVTCVRCPEK       300
     NLLPEALEVG IDLGTYHYGE QTITFSRTTT GIPFSAVQFP LTIRSVLPGD RIRLAVGTKK       360
     VSRILVDAKV PRASRAEIPV VVDAAGQVLA VIGHRIAIFG SFELLAESCL MIEW             414
//

If you have problems or comments...

PBIL Back to PBIL home page