(data stored in ACNUC7421 zone)

EMBL: CP001022.PE490

CP001022.PE490       Location/Qualifiers
FT   CDS             complement(531115..531312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59978"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ48"
FT                   /protein_id="ACB59978.1"
FT                   /translation="MTPLFEERLMADLFSSTNNPSYGLPTLPVYETDGLTKELQARIVN
FT                   DAEQKSLSLGIIQSREEEHV"
     MTPLFEERLM ADLFSSTNNP SYGLPTLPVY ETDGLTKELQ ARIVNDAEQK SLSLGIIQSR        60
     EEEHV                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page