(data stored in ACNUC7421 zone)

EMBL: CP001022.PE494

CP001022.PE494       Location/Qualifiers
FT   CDS             complement(534348..535982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0500"
FT                   /product="4-phytase"
FT                   /EC_number="3.1.3.26"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: btl:BALH_1801 oligopeptide transporter,
FT                   periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59982"
FT                   /db_xref="GOA:B1YJ52"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ52"
FT                   /protein_id="ACB59982.1"
FT                   /translation="MKKQTKIAFAGLSSMALLAVAACGQSNESDGNSSSSKEKKQEVTL
FT                   ISTTDVPQLDPTKTTDSTSIIVTNNVFEGLYRLDGDNKPTAGIAESVEVSDDKKTYTFK
FT                   LRKDAKWSDGSAVTADDFIYSWKRALDPKTGAEYAYILQDLKNANKILAGEAELDSLGV
FT                   KKVDDQTLEVQLEAPAPYFLGLTSFPTYLPLKQSFVEEKGDKFATNVDSMLFNGPFILD
FT                   KWQSNSGWTYKKNPDYWDKANVKMEKIDVKVVKEISTGVNLFESKDVDFAPITSEFVSQ
FT                   YEKSDNYKTRPDARINFLRFNQKNKALKNENIRKALALGFEKQGITDVILNDGSKPANF
FT                   IVAKDFTFTPDGEDFRAKYPDLQSFDATEAKKAWDSGLKELGVKTVELDMLSRDEDAFK
FT                   KVSEFLKGDLEKNLPGLTVNIKQQPFKNFLDLESKGDYDISAAGWGPDYQDPMTFLDMC
FT                   LTGGSFNRMEYSNKEFDKMIKEAKAEPDEAKRWSTLQEAEKMLLAEDYAIAPIYQKGEA
FT                   YLQRANIDKLYRHPFGADMSFKWMEVK"
     MKKQTKIAFA GLSSMALLAV AACGQSNESD GNSSSSKEKK QEVTLISTTD VPQLDPTKTT        60
     DSTSIIVTNN VFEGLYRLDG DNKPTAGIAE SVEVSDDKKT YTFKLRKDAK WSDGSAVTAD       120
     DFIYSWKRAL DPKTGAEYAY ILQDLKNANK ILAGEAELDS LGVKKVDDQT LEVQLEAPAP       180
     YFLGLTSFPT YLPLKQSFVE EKGDKFATNV DSMLFNGPFI LDKWQSNSGW TYKKNPDYWD       240
     KANVKMEKID VKVVKEISTG VNLFESKDVD FAPITSEFVS QYEKSDNYKT RPDARINFLR       300
     FNQKNKALKN ENIRKALALG FEKQGITDVI LNDGSKPANF IVAKDFTFTP DGEDFRAKYP       360
     DLQSFDATEA KKAWDSGLKE LGVKTVELDM LSRDEDAFKK VSEFLKGDLE KNLPGLTVNI       420
     KQQPFKNFLD LESKGDYDIS AAGWGPDYQD PMTFLDMCLT GGSFNRMEYS NKEFDKMIKE       480
     AKAEPDEAKR WSTLQEAEKM LLAEDYAIAP IYQKGEAYLQ RANIDKLYRH PFGADMSFKW       540
     MEVK                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page