(data stored in ACNUC7421 zone)

EMBL: CP001022.PE500

CP001022.PE500       Location/Qualifiers
FT   CDS             542309..543817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0506"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, N-acetylglucosamine-specific
FT                   IIBC subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system PTS EIIB protein;
FT                   phosphotransferase system EIIC; KEGG: bce:BC0482 PTS
FT                   system, N-acetylglucosamine-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59988"
FT                   /db_xref="GOA:B1YJ58"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ58"
FT                   /protein_id="ACB59988.1"
FT                   /translation="MLQFLQRIGKALMLPIAVLPAAGIVLRLGSADMLDIPLMVAAGGA
FT                   IFDNLPLIFAIGVAIGLSIDASGAAGLAGAVGYLVLKTGVDSMNKDYSNAQIQAKYDAI
FT                   AAIVNDSSTKVDGATLSSIANQATLGSMVNMAVFGGIIAGIVAGLLYNRFYNIKLPDWL
FT                   AFFGGRRFVPIITSAAMLVLAFVFGYLWPFIEDGINNAGEWMVSLGAGGAALFGFFNRL
FT                   LIPVGLHHVLNNIFWFVFGSYEKADGTIANGDIARFFAGDPTAGIYQAGFFPIMMFALP
FT                   AAAAAMVMAARKENRKAVAGAMIGLGLTSFLTGITEPIEFSFMFLSPVLYVMHAVLTGV
FT                   SMAVVNLLGILHGFSFSAGFIDYVLNFGIATKPLLLLVVGLVFAVIYYFLFYFMITKFD
FT                   LKTPGREDESLVTDAGPVTGVSDDKYEQQAARIFAGLQGTDNVTAIDNCATRLRLQVKD
FT                   STIIDEAAIKAAGAKGVMKMGAKNVQIIIGTDVEFVADAMKRQK"
     MLQFLQRIGK ALMLPIAVLP AAGIVLRLGS ADMLDIPLMV AAGGAIFDNL PLIFAIGVAI        60
     GLSIDASGAA GLAGAVGYLV LKTGVDSMNK DYSNAQIQAK YDAIAAIVND SSTKVDGATL       120
     SSIANQATLG SMVNMAVFGG IIAGIVAGLL YNRFYNIKLP DWLAFFGGRR FVPIITSAAM       180
     LVLAFVFGYL WPFIEDGINN AGEWMVSLGA GGAALFGFFN RLLIPVGLHH VLNNIFWFVF       240
     GSYEKADGTI ANGDIARFFA GDPTAGIYQA GFFPIMMFAL PAAAAAMVMA ARKENRKAVA       300
     GAMIGLGLTS FLTGITEPIE FSFMFLSPVL YVMHAVLTGV SMAVVNLLGI LHGFSFSAGF       360
     IDYVLNFGIA TKPLLLLVVG LVFAVIYYFL FYFMITKFDL KTPGREDESL VTDAGPVTGV       420
     SDDKYEQQAA RIFAGLQGTD NVTAIDNCAT RLRLQVKDST IIDEAAIKAA GAKGVMKMGA       480
     KNVQIIIGTD VEFVADAMKR QK                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page