(data stored in ACNUC7421 zone)

EMBL: CP001022.PE501

CP001022.PE501       Location/Qualifiers
FT   CDS             complement(543850..544755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0507"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; UAA transporter; KEGG: btl:BALH_4572
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59989"
FT                   /db_xref="GOA:B1YJ59"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ59"
FT                   /protein_id="ACB59989.1"
FT                   /translation="MNRSKATLFVLIGAISYGVLSTIVKLAYGAGFDSAAVSGSQFFFG
FT                   WLMIFVLALLSKNLRLHPKTALTLMAIGISSGTTGYLYYQSLQTVSASVAIILLFQFTW
FT                   IGVVIDSILAKRLPSRSHFLSAVLLIGGAVLASAAYTSALDVRGTLFGLGAAVSFSIFL
FT                   LASGRVANHVPVIKKSFYMMTGGLLFVMIMYPPTTFLTATNFEQGLIWYALPLGLFALI
FT                   LPPLLFAAGAPHLSPASVSLLGAAELPTAVICSVLILGEHLSGSQWIGIIIILIGIFYP
FT                   IYVSSLKQSTTSVPRQNDLS"
     MNRSKATLFV LIGAISYGVL STIVKLAYGA GFDSAAVSGS QFFFGWLMIF VLALLSKNLR        60
     LHPKTALTLM AIGISSGTTG YLYYQSLQTV SASVAIILLF QFTWIGVVID SILAKRLPSR       120
     SHFLSAVLLI GGAVLASAAY TSALDVRGTL FGLGAAVSFS IFLLASGRVA NHVPVIKKSF       180
     YMMTGGLLFV MIMYPPTTFL TATNFEQGLI WYALPLGLFA LILPPLLFAA GAPHLSPASV       240
     SLLGAAELPT AVICSVLILG EHLSGSQWIG IIIILIGIFY PIYVSSLKQS TTSVPRQNDL       300
     S                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page