(data stored in ACNUC7421 zone)

EMBL: CP001022.PE507

CP001022.PE507       Location/Qualifiers
FT   CDS             complement(548851..549417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0513"
FT                   /product="protein of unknown function DUF1541"
FT                   /note="PFAM: protein of unknown function DUF1541; KEGG:
FT                   bsu:BSU05790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59995"
FT                   /db_xref="InterPro:IPR011438"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG5"
FT                   /protein_id="ACB59995.1"
FT                   /translation="MKKQLFVTSLALSAVIGLSACGSDSNSSNSHDMHDDMKDSHAGMM
FT                   HSSDGKIPAGLKQAENPKFKDGANVVLSSDHMKGMDGAEATVVDSFDTTVYAVSFTPTN
FT                   GGKKVSNHKWVIQEELSPVPDSPLKAGDKVTLAADHMKGMDGAKATIDQADETTVYMVD
FT                   FKPTTGGKTIKNHKWVTEDELQAKN"
     MKKQLFVTSL ALSAVIGLSA CGSDSNSSNS HDMHDDMKDS HAGMMHSSDG KIPAGLKQAE        60
     NPKFKDGANV VLSSDHMKGM DGAEATVVDS FDTTVYAVSF TPTNGGKKVS NHKWVIQEEL       120
     SPVPDSPLKA GDKVTLAADH MKGMDGAKAT IDQADETTVY MVDFKPTTGG KTIKNHKWVT       180
     EDELQAKN                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page