(data stored in ACNUC7421 zone)

EMBL: CP001022.PE508

CP001022.PE508       Location/Qualifiers
FT   CDS             549570..550931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0514"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: gtn:GTNG_1608 two component
FT                   system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59996"
FT                   /db_xref="GOA:B1YJG6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG6"
FT                   /protein_id="ACB59996.1"
FT                   /translation="MRHISYYIGLLFLTAILVIGGILFSTLYFNLVNQRTDEVVLGLLN
FT                   RGNTHRDVLEESFNAETLEHVSLMESASEFTVVITDQKGKILKASHPLTPKMKVELIHT
FT                   EFQTQRKDRILRAQAETKGFFMTDSPITISGVHRGHVFMFAPETLIQQVVDPLRQQFIQ
FT                   VGIIAVLLSLTTVVLCTRLISRPLIEMERATAKLKEGNLDVDLPVNRSDELGALARSIT
FT                   QLAKDLDFLNRERTEFLANISHELRTPLTYMKGYADILHRPNLPESEKTAYLSIIKEES
FT                   DHLSTLIEQMMLLARSDTNAFSVERVPLALDQLIVSTTEKMRPAIEEKGLHLHVSGEPV
FT                   EIAGDEIRLKQVLINVLDNAKKYTATGEIVVRYGRNETGPYFQVRDTGSGISQESLPHV
FT                   TKRLYRSEPSRSRSRGGSGLGLTIALAIVQAHDATLDIKSEKNAGTSVMIQWKV"
     MRHISYYIGL LFLTAILVIG GILFSTLYFN LVNQRTDEVV LGLLNRGNTH RDVLEESFNA        60
     ETLEHVSLME SASEFTVVIT DQKGKILKAS HPLTPKMKVE LIHTEFQTQR KDRILRAQAE       120
     TKGFFMTDSP ITISGVHRGH VFMFAPETLI QQVVDPLRQQ FIQVGIIAVL LSLTTVVLCT       180
     RLISRPLIEM ERATAKLKEG NLDVDLPVNR SDELGALARS ITQLAKDLDF LNRERTEFLA       240
     NISHELRTPL TYMKGYADIL HRPNLPESEK TAYLSIIKEE SDHLSTLIEQ MMLLARSDTN       300
     AFSVERVPLA LDQLIVSTTE KMRPAIEEKG LHLHVSGEPV EIAGDEIRLK QVLINVLDNA       360
     KKYTATGEIV VRYGRNETGP YFQVRDTGSG ISQESLPHVT KRLYRSEPSR SRSRGGSGLG       420
     LTIALAIVQA HDATLDIKSE KNAGTSVMIQ WKV                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page