(data stored in ACNUC7421 zone)

EMBL: CP001022.PE51

CP001022.PE51        Location/Qualifiers
FT   CDS             69557..71563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0052"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: bwe:BcerKBAB4_0060 ATP-dependent
FT                   metalloprotease FtsH; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein; peptidase M41 FtsH extracellular;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59539"
FT                   /db_xref="GOA:B1YGQ6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ6"
FT                   /protein_id="ACB59539.1"
FT                   /translation="MNRAVKNTLVFGVIFLALILFLQYLQSPVNKSKEINYTQFVESVE
FT                   KGDVKTATFQYEGQTYNVTGELREKDTTYETVVPAVDTELTDLYTQLRSQNVKMDFKAA
FT                   ETNGGWIALLTTIVPFIIIFILFFFLINQAQGGGGGGRVMNFGKSKARLYDTEKKKITF
FT                   DDVAGADEEKQELVEVVEFLKDPRKFARLGARIPKGVLLVGPPGTGKTLLARAAAGEAG
FT                   VPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHD
FT                   EREQTLNQLLVEMDGFSENEGIIMIAATNRADILDPALLRPGRFDRQITVERPDVVGRE
FT                   AVLKVHARNKPLDTTVDLKAIAQRTPGFSGADLENLLNEAALIAARTDRDKISIVDLEE
FT                   AIDRVIAGPAKKSRIISPKEKKIVAWHEAGHTIIGVTLDDADEVHKVTIVPRGNAGGYV
FT                   IMLPKEDRYFMTKPELEDKITGLLGGRVAEDIVFGEVSTGASNDFQRATGLARKMVMEF
FT                   GMSEKLGPLQFGSGQGGNVFLGRDFQNEQNYSDAIAHEIDMEIQAIINKCYQKAKTILT
FT                   EKRDQLDLIATTLLEVETLDQKQIHHLLETGEYKKHEPAAITEPKAEEKTPESTTPVID
FT                   QPTESPTQRGSVIDEGQNVDTENPDQPRRDDQI"
     MNRAVKNTLV FGVIFLALIL FLQYLQSPVN KSKEINYTQF VESVEKGDVK TATFQYEGQT        60
     YNVTGELREK DTTYETVVPA VDTELTDLYT QLRSQNVKMD FKAAETNGGW IALLTTIVPF       120
     IIIFILFFFL INQAQGGGGG GRVMNFGKSK ARLYDTEKKK ITFDDVAGAD EEKQELVEVV       180
     EFLKDPRKFA RLGARIPKGV LLVGPPGTGK TLLARAAAGE AGVPFFSISG SDFVEMFVGV       240
     GASRVRDLFE NAKKNAPCII FIDEIDAVGR QRGAGLGGGH DEREQTLNQL LVEMDGFSEN       300
     EGIIMIAATN RADILDPALL RPGRFDRQIT VERPDVVGRE AVLKVHARNK PLDTTVDLKA       360
     IAQRTPGFSG ADLENLLNEA ALIAARTDRD KISIVDLEEA IDRVIAGPAK KSRIISPKEK       420
     KIVAWHEAGH TIIGVTLDDA DEVHKVTIVP RGNAGGYVIM LPKEDRYFMT KPELEDKITG       480
     LLGGRVAEDI VFGEVSTGAS NDFQRATGLA RKMVMEFGMS EKLGPLQFGS GQGGNVFLGR       540
     DFQNEQNYSD AIAHEIDMEI QAIINKCYQK AKTILTEKRD QLDLIATTLL EVETLDQKQI       600
     HHLLETGEYK KHEPAAITEP KAEEKTPEST TPVIDQPTES PTQRGSVIDE GQNVDTENPD       660
     QPRRDDQI                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page