(data stored in ACNUC7421 zone)

EMBL: CP001022.PE512

CP001022.PE512       Location/Qualifiers
FT   CDS             complement(553745..554290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0518"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: xcv:XCV0113 putative protein-S isoprenylcysteine
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60000"
FT                   /db_xref="GOA:B1YJH0"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH0"
FT                   /protein_id="ACB60000.1"
FT                   /translation="MTILDKVFIAVSLLWLFELFLFRNRKKEPSPLEERQSFYWILATL
FT                   ITTILFSVLFSDSIRLPLSREIGLLLLTSGVVLRYWGIYHLKHQFTRHVAVNPGDRLVS
FT                   TGPYRALRHPLYSGLFFITLGFPLYFGNLFVTLCAGILMFIALLHRIRIEEQMLTKGFG
FT                   PAYTDWARKRKRLIPFIY"
     MTILDKVFIA VSLLWLFELF LFRNRKKEPS PLEERQSFYW ILATLITTIL FSVLFSDSIR        60
     LPLSREIGLL LLTSGVVLRY WGIYHLKHQF TRHVAVNPGD RLVSTGPYRA LRHPLYSGLF       120
     FITLGFPLYF GNLFVTLCAG ILMFIALLHR IRIEEQMLTK GFGPAYTDWA RKRKRLIPFI       180
     Y                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page