(data stored in ACNUC7421 zone)

EMBL: CP001022.PE513

CP001022.PE513       Location/Qualifiers
FT   CDS             554526..555338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0519"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; SH3 type 3 domain protein; KEGG: cdf:CD2504
FT                   putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60001"
FT                   /db_xref="GOA:B1YJH1"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH1"
FT                   /protein_id="ACB60001.1"
FT                   /translation="MKKLKQTVIGLLAILLSLVSFSLAAEASSYRQAKTPLNLRSGAST
FT                   TKAVVAVIPTTVYVNEISRLGTWSKVRYGTQTGYASTKYLLTDQQIGGLRIGKTLIVNP
FT                   NLPLRSTYAPGESTVARAAFEKMKRAAKAEKITLVAFSTYRSYAYQKALFEKYVARDGF
FT                   EKASTYSAQPGKSEHQTGLGFDIGGADSSKYAKFSFSSTKEAKWLAANAHRFGFHLRYP
FT                   LGKESWTGYTYESWHYRYVGATLAAQLKMTGLTMEEYYQLAPGKPSTP"
     MKKLKQTVIG LLAILLSLVS FSLAAEASSY RQAKTPLNLR SGASTTKAVV AVIPTTVYVN        60
     EISRLGTWSK VRYGTQTGYA STKYLLTDQQ IGGLRIGKTL IVNPNLPLRS TYAPGESTVA       120
     RAAFEKMKRA AKAEKITLVA FSTYRSYAYQ KALFEKYVAR DGFEKASTYS AQPGKSEHQT       180
     GLGFDIGGAD SSKYAKFSFS STKEAKWLAA NAHRFGFHLR YPLGKESWTG YTYESWHYRY       240
     VGATLAAQLK MTGLTMEEYY QLAPGKPSTP                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page