(data stored in ACNUC7421 zone)

EMBL: CP001022.PE514

CP001022.PE514       Location/Qualifiers
FT   CDS             complement(555956..559060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0521"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   gka:GK2569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60002"
FT                   /db_xref="GOA:B1YJH2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH2"
FT                   /protein_id="ACB60002.1"
FT                   /translation="MNFLTRFSLKNSVAVFIIAILLVLGGVYSFSQLKVDQFPEIEFPQ
FT                   ISVEAVYPGASPDDVDKQVVSKLETALKGIEGSTKITSSAYESIGIINIEFPFDTDMDK
FT                   VEQQIDAAIQDANLPEEATTKLNRFSFGSFPIYNISFFSKDGKEIESLLKNEIEPELNK
FT                   IPGINSVSVGGYKDDLVQITVDNKKATAAGLSLSSIKEQINAKYVSFPSGQLAEGDSKI
FT                   PIRVEEKLENLDKLKNLQLTSSVASGAASGGQGQPAQSGPPAGATGETGAPTEQAEPVR
FT                   LSDIATIEAVSKQSEKTRYDLKDSLSMAITKKQDANTVEIADGVTKILNKYDDQIDYTI
FT                   GIDSAKDIEESVATLVKEGLLGALFASLAVLLFLRNIRATIIAIVSIPLSLLIAAIFLN
FT                   WQAISLNIMTLGGMAVAVGRVVDDSIVVIENIFRRVRKSDGGMTDEVIEQSTKEILKAI
FT                   TSSTLTTVVVFLPIGFVGGITGKFFLPFALTIIFSLLASLLVAITIVPILAKFAFKKVP
FT                   AEEKEGVLQRWYGTLIEKSLSHKAIILVVSFLLLGGSLAIVPQLGFTFIPNEASKTLTA
FT                   SLELPAATSLEKTSDVSLNMEKMFDQENAIADVTTSVGARDFTTGLRLDNKASYFLNLK
FT                   DGADVEKTIKSLETKMDDIAKEDGVDVKISVAELSTGGPPSNNNVDVDLFSTDLEALQK
FT                   AAKLVEDNMNKNNDLKYVTNNFSEKQKQFLVEIDSEKASDRGLSGFQILGTVNDQTKPV
FT                   TVGTLNLDDKDQDVQLSYKEDLTSKEDLENVQLFSAAGPVALKDVATVNEVDTFTSIQK
FT                   LDGKVYARVSGQVKGDNVQTVSSDVKAAVEKIDLPDGVSLTSGGGNDDTVEIFQSLGIA
FT                   IVVAIGLVYLTMLITFGKARIPFIILSSLIFVPIGSLVTLFLANEPLSVSVMIGFLMLI
FT                   GIVTTNAIVLVDRIGQNITRGLPVRESLIEAGKTRLRPILMTAFATIMALVPLALTTSS
FT                   GTLISKGLALTVIGGLTTSTLLTLIIVPVVYELFFFKKVKKERQS"
     MNFLTRFSLK NSVAVFIIAI LLVLGGVYSF SQLKVDQFPE IEFPQISVEA VYPGASPDDV        60
     DKQVVSKLET ALKGIEGSTK ITSSAYESIG IINIEFPFDT DMDKVEQQID AAIQDANLPE       120
     EATTKLNRFS FGSFPIYNIS FFSKDGKEIE SLLKNEIEPE LNKIPGINSV SVGGYKDDLV       180
     QITVDNKKAT AAGLSLSSIK EQINAKYVSF PSGQLAEGDS KIPIRVEEKL ENLDKLKNLQ       240
     LTSSVASGAA SGGQGQPAQS GPPAGATGET GAPTEQAEPV RLSDIATIEA VSKQSEKTRY       300
     DLKDSLSMAI TKKQDANTVE IADGVTKILN KYDDQIDYTI GIDSAKDIEE SVATLVKEGL       360
     LGALFASLAV LLFLRNIRAT IIAIVSIPLS LLIAAIFLNW QAISLNIMTL GGMAVAVGRV       420
     VDDSIVVIEN IFRRVRKSDG GMTDEVIEQS TKEILKAITS STLTTVVVFL PIGFVGGITG       480
     KFFLPFALTI IFSLLASLLV AITIVPILAK FAFKKVPAEE KEGVLQRWYG TLIEKSLSHK       540
     AIILVVSFLL LGGSLAIVPQ LGFTFIPNEA SKTLTASLEL PAATSLEKTS DVSLNMEKMF       600
     DQENAIADVT TSVGARDFTT GLRLDNKASY FLNLKDGADV EKTIKSLETK MDDIAKEDGV       660
     DVKISVAELS TGGPPSNNNV DVDLFSTDLE ALQKAAKLVE DNMNKNNDLK YVTNNFSEKQ       720
     KQFLVEIDSE KASDRGLSGF QILGTVNDQT KPVTVGTLNL DDKDQDVQLS YKEDLTSKED       780
     LENVQLFSAA GPVALKDVAT VNEVDTFTSI QKLDGKVYAR VSGQVKGDNV QTVSSDVKAA       840
     VEKIDLPDGV SLTSGGGNDD TVEIFQSLGI AIVVAIGLVY LTMLITFGKA RIPFIILSSL       900
     IFVPIGSLVT LFLANEPLSV SVMIGFLMLI GIVTTNAIVL VDRIGQNITR GLPVRESLIE       960
     AGKTRLRPIL MTAFATIMAL VPLALTTSSG TLISKGLALT VIGGLTTSTL LTLIIVPVVY      1020
     ELFFFKKVKK ERQS                                                        1034
//

If you have problems or comments...

PBIL Back to PBIL home page