(data stored in ACNUC7421 zone)

EMBL: CP001022.PE516

CP001022.PE516       Location/Qualifiers
FT   CDS             560763..561497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0523"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ssp:SSP0734
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60004"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH4"
FT                   /protein_id="ACB60004.1"
FT                   /translation="MKFAVITDIHGNATALEAVLKRITEEADVSEIFCLGDLIGIGPQT
FT                   NEVIEIVRSTPHMTTISGNHDENVLALIHGQKYPDSYRHAKKHHQWIADQLTPDNQRFL
FT                   EQLPRTVRKTFSEQEALFTHYAYLDETKAIGEEPLADTVDGTEQSLPELFKGEQASLIC
FT                   FGHHHPKQLVRAMGITYLNPGALGCQPEAVAPFAVVELNSGEWNVNVIEVKYDDRPYLE
FT                   AFNAAPMPEKELLRKLFLGGRT"
     MKFAVITDIH GNATALEAVL KRITEEADVS EIFCLGDLIG IGPQTNEVIE IVRSTPHMTT        60
     ISGNHDENVL ALIHGQKYPD SYRHAKKHHQ WIADQLTPDN QRFLEQLPRT VRKTFSEQEA       120
     LFTHYAYLDE TKAIGEEPLA DTVDGTEQSL PELFKGEQAS LICFGHHHPK QLVRAMGITY       180
     LNPGALGCQP EAVAPFAVVE LNSGEWNVNV IEVKYDDRPY LEAFNAAPMP EKELLRKLFL       240
     GGRT                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page