(data stored in ACNUC7421 zone)

EMBL: CP001022.PE524

CP001022.PE524       Location/Qualifiers
FT   CDS             568609..569814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0531"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: oih:OB0264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60012"
FT                   /db_xref="GOA:B1YJI2"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI2"
FT                   /protein_id="ACB60012.1"
FT                   /translation="MQKLKLVYRETNWWWPLLYGVGGAVLTAVVLMVDLYAKELFPNDW
FT                   KTTLGLAQTIHSAVFTGLLTMMTFTFSTILVVLTTYSSQFSPRTLPNFIENRQVQHIFG
FT                   IFIGTVTYSITMLFFMRSSLKDSVVASAVAVIVVLIAVIAFVAFVHIVSQSIRVTTLLD
FT                   RLHEEGCTLIEEHVEAINGGQYQLVPENRSTYSFGLTALQTGYLQAIDYELLMKSGERV
FT                   AIEVTIGSYVTQGQRIGSAEKENVEQGILVGPTRSAEQDFAFVIQKLSEVALRAISPGI
FT                   NDPNTARHAMRQIGDLFRRYTMLLDGNLLVNGEGSVTVKRLAFSELLYLTFYQLRHYGE
FT                   EDISVLSTMLESLEIMKRNALPEHRASIDRFIPFVCSEVDWSALNDWDRQHLEQAQKRA
FT                   LS"
     MQKLKLVYRE TNWWWPLLYG VGGAVLTAVV LMVDLYAKEL FPNDWKTTLG LAQTIHSAVF        60
     TGLLTMMTFT FSTILVVLTT YSSQFSPRTL PNFIENRQVQ HIFGIFIGTV TYSITMLFFM       120
     RSSLKDSVVA SAVAVIVVLI AVIAFVAFVH IVSQSIRVTT LLDRLHEEGC TLIEEHVEAI       180
     NGGQYQLVPE NRSTYSFGLT ALQTGYLQAI DYELLMKSGE RVAIEVTIGS YVTQGQRIGS       240
     AEKENVEQGI LVGPTRSAEQ DFAFVIQKLS EVALRAISPG INDPNTARHA MRQIGDLFRR       300
     YTMLLDGNLL VNGEGSVTVK RLAFSELLYL TFYQLRHYGE EDISVLSTML ESLEIMKRNA       360
     LPEHRASIDR FIPFVCSEVD WSALNDWDRQ HLEQAQKRAL S                           401
//

If you have problems or comments...

PBIL Back to PBIL home page