(data stored in ACNUC7421 zone)

EMBL: CP001022.PE526

CP001022.PE526       Location/Qualifiers
FT   CDS             570505..571890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0533"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: sha:SH2193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60014"
FT                   /db_xref="GOA:B1YJI4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI4"
FT                   /protein_id="ACB60014.1"
FT                   /translation="MEVNPLSLGKRLDSTHAVETFDTTTIIIRLLIIALLIVLTAFFVA
FT                   AEFSVVKMRMSRIDQLITEGSKTAKTAKKLLDNLDYYLSACQLGITVTALGLGWLGEST
FT                   VGAILAMVFKEIALPESVSTVVSFTLAFSVVTFLHVVLGELAPKSLAIQKTEAITMLLA
FT                   PPLYWFGKVMKPVIWLLNGSARVFLRLFGVEPVGHEDAHSEEEIKIIMTQSYKSGEINQ
FT                   TELSYMQNIFSFDERIAKDIMLPRTDLITISNDASMEDIIALVEEYQFTRYPVAEEGDK
FT                   DKILGFINAKQLFTDHMANKGKALSFYVHNLPIVSEYSPLQDAMLKMQVERTPMALVID
FT                   EYGGTAGVITMEDILEEIVGEIRDEFDKDEKADIEQIHERLYRISGRVLIDDLNERFNL
FT                   GIEEEDIDTIGGWVMAQDTEVSSGQEFRYKNHTVKVMEVDNHQVKSIYLQLPEKEPVTE
FT                   EIV"
     MEVNPLSLGK RLDSTHAVET FDTTTIIIRL LIIALLIVLT AFFVAAEFSV VKMRMSRIDQ        60
     LITEGSKTAK TAKKLLDNLD YYLSACQLGI TVTALGLGWL GESTVGAILA MVFKEIALPE       120
     SVSTVVSFTL AFSVVTFLHV VLGELAPKSL AIQKTEAITM LLAPPLYWFG KVMKPVIWLL       180
     NGSARVFLRL FGVEPVGHED AHSEEEIKII MTQSYKSGEI NQTELSYMQN IFSFDERIAK       240
     DIMLPRTDLI TISNDASMED IIALVEEYQF TRYPVAEEGD KDKILGFINA KQLFTDHMAN       300
     KGKALSFYVH NLPIVSEYSP LQDAMLKMQV ERTPMALVID EYGGTAGVIT MEDILEEIVG       360
     EIRDEFDKDE KADIEQIHER LYRISGRVLI DDLNERFNLG IEEEDIDTIG GWVMAQDTEV       420
     SSGQEFRYKN HTVKVMEVDN HQVKSIYLQL PEKEPVTEEI V                           461
//

If you have problems or comments...

PBIL Back to PBIL home page