(data stored in ACNUC7421 zone)

EMBL: CP001022.PE527

CP001022.PE527       Location/Qualifiers
FT   CDS             572037..572477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0534"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bcl:ABC1785 organic
FT                   hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60015"
FT                   /db_xref="GOA:B1YJI5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI5"
FT                   /protein_id="ACB60015.1"
FT                   /translation="MTKTILTSRATAVGGRDGKVASDDNVINLDLVMPGTKGKEDIPTS
FT                   NPEQLFAAGYAACFDGAFNLMARQDKKRVETRTNSEVSLLEDEEAGGVKIAAKLVVEVV
FT                   GVTEEEAQDLLEKTHQFCPYSKATRGNIDVDLSVKVVDSLDN"
     MTKTILTSRA TAVGGRDGKV ASDDNVINLD LVMPGTKGKE DIPTSNPEQL FAAGYAACFD        60
     GAFNLMARQD KKRVETRTNS EVSLLEDEEA GGVKIAAKLV VEVVGVTEEE AQDLLEKTHQ       120
     FCPYSKATRG NIDVDLSVKV VDSLDN                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page