(data stored in ACNUC7421 zone)

EMBL: CP001022.PE529

CP001022.PE529       Location/Qualifiers
FT   CDS             572710..573222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0536"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: bsu:BSU07850 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60017"
FT                   /db_xref="GOA:B1YJI7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI7"
FT                   /protein_id="ACB60017.1"
FT                   /translation="MGKKVAVVLADHFEDVEFTGPVDALKEAGHEVTVIGTEKGAELVG
FT                   KQEEAKVTVDVTIDETSSSDFDALLIPGGFSPDLLREDDRFVTFTEEFDTSKKPIFSIC
FT                   HGPQLMINAKIVKGRKMTGYKSIRIDLENAGVSYEDKEVVVDDNFVSSRQPDDIPAFNR
FT                   EMLAKLG"
     MGKKVAVVLA DHFEDVEFTG PVDALKEAGH EVTVIGTEKG AELVGKQEEA KVTVDVTIDE        60
     TSSSDFDALL IPGGFSPDLL REDDRFVTFT EEFDTSKKPI FSICHGPQLM INAKIVKGRK       120
     MTGYKSIRID LENAGVSYED KEVVVDDNFV SSRQPDDIPA FNREMLAKLG                  170
//

If you have problems or comments...

PBIL Back to PBIL home page