(data stored in ACNUC7421 zone)

EMBL: CP001022.PE53

CP001022.PE53        Location/Qualifiers
FT   CDS             72548..73474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0054"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: oih:OB0082 chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59541"
FT                   /db_xref="GOA:B1YGQ8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ8"
FT                   /protein_id="ACB59541.1"
FT                   /translation="MKREELLAQLKDDYLVRALGFNGEVRAFAIRSTKTVYEAQLRHQT
FT                   TPVVTAALGRTLTIGAMMGTMQKGDTRVTLKVEGDGPIGKIIVDADAKGQVRGYVSHPR
FT                   VEMDTYVNGDGLTKLKVGDAVGRGNISVIKDLGLRDFVGGQSPIQTGEISEDFTYYFAV
FT                   SEQSPSVVGAGVLVYPEDESVIAAGGLIVQLMPGASEETIAALEQRVAALKPISILVGE
FT                   EKTPEEMLSLVLGESFEILDTIPVAFNCTCEREKLATAIVALGPDEIQAMIDEDGGAEA
FT                   VCHFCSEHYQYDVEELQSLREKSLERA"
     MKREELLAQL KDDYLVRALG FNGEVRAFAI RSTKTVYEAQ LRHQTTPVVT AALGRTLTIG        60
     AMMGTMQKGD TRVTLKVEGD GPIGKIIVDA DAKGQVRGYV SHPRVEMDTY VNGDGLTKLK       120
     VGDAVGRGNI SVIKDLGLRD FVGGQSPIQT GEISEDFTYY FAVSEQSPSV VGAGVLVYPE       180
     DESVIAAGGL IVQLMPGASE ETIAALEQRV AALKPISILV GEEKTPEEML SLVLGESFEI       240
     LDTIPVAFNC TCEREKLATA IVALGPDEIQ AMIDEDGGAE AVCHFCSEHY QYDVEELQSL       300
     REKSLERA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page