(data stored in ACNUC7421 zone)

EMBL: CP001022.PE530

CP001022.PE530       Location/Qualifiers
FT   CDS             complement(573277..573684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0537"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bca:BCE_1995 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60018"
FT                   /db_xref="GOA:B1YJI8"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI8"
FT                   /protein_id="ACB60018.1"
FT                   /translation="MYLDHTGIAVRDMQEAITFYTTVLGGTLIREYSNPTPGVASNIAV
FT                   IEFEDAHIELLTPTSPESPIARFLKQRGKGVHHIAYRVDDLDQAILEAKQRGITFLEDT
FT                   YRQTPLGRRLIYMDPRHSHGVITELCDYPEN"
     MYLDHTGIAV RDMQEAITFY TTVLGGTLIR EYSNPTPGVA SNIAVIEFED AHIELLTPTS        60
     PESPIARFLK QRGKGVHHIA YRVDDLDQAI LEAKQRGITF LEDTYRQTPL GRRLIYMDPR       120
     HSHGVITELC DYPEN                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page