(data stored in ACNUC7421 zone)

EMBL: CP001022.PE533

CP001022.PE533       Location/Qualifiers
FT   CDS             577149..577958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0540"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: cbe:Cbei_4490 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM: protein of
FT                   unknown function UPF0031; Phosphomethylpyrimidine kinase
FT                   type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60021"
FT                   /db_xref="GOA:B1YJJ1"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ1"
FT                   /protein_id="ACB60021.1"
FT                   /translation="MKHVLTIAGSDSGGGAGIQADLKTFSALGVYGMSVITAITAQNTL
FT                   GVQAVEDVSPELVEAQLTSIFSDIRVDAVKIGMVSNQDTIQVIARQLEKYSLPIVLDPV
FT                   MVAKGGHALLQPNAEQALLEQLLPLATLVTPNIPEIERMIGGTVHSLADMKQAAVKLTE
FT                   RRAGAVLLKGGHLEGQDATDLLYTDERYVVFEQERIASRHTHGTGCTLSAAIAGNLALG
FT                   HSLEDSIRYAKRYVTEAIRHGFALGHGIGPTHHFHELWRDTHVTTHP"
     MKHVLTIAGS DSGGGAGIQA DLKTFSALGV YGMSVITAIT AQNTLGVQAV EDVSPELVEA        60
     QLTSIFSDIR VDAVKIGMVS NQDTIQVIAR QLEKYSLPIV LDPVMVAKGG HALLQPNAEQ       120
     ALLEQLLPLA TLVTPNIPEI ERMIGGTVHS LADMKQAAVK LTERRAGAVL LKGGHLEGQD       180
     ATDLLYTDER YVVFEQERIA SRHTHGTGCT LSAAIAGNLA LGHSLEDSIR YAKRYVTEAI       240
     RHGFALGHGI GPTHHFHELW RDTHVTTHP                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page