(data stored in ACNUC7421 zone)

EMBL: CP001022.PE538

CP001022.PE538       Location/Qualifiers
FT   CDS             complement(580357..581001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_4865 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60026"
FT                   /db_xref="GOA:B1YJJ6"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ6"
FT                   /protein_id="ACB60026.1"
FT                   /translation="MNQLWRHRIILILVVSLFASIPLLYALSGYRTISKLTAEMHTQDI
FT                   PMIKQVDQLIEHNRDRANAVRGLLLYEDDRYIEQYYFSTSKVHDLRRLLNSSNQTPGAV
FT                   KDLLSRNNTWEEEIQEVFTVYETDHPQRAKKLAKQTTQTTQTILEDLSQIKDKLYRDLE
FT                   QKLELTTEMTAEYKRMCFSLSILAFLLIATTIILFHRSKPILENKTNTYRP"
     MNQLWRHRII LILVVSLFAS IPLLYALSGY RTISKLTAEM HTQDIPMIKQ VDQLIEHNRD        60
     RANAVRGLLL YEDDRYIEQY YFSTSKVHDL RRLLNSSNQT PGAVKDLLSR NNTWEEEIQE       120
     VFTVYETDHP QRAKKLAKQT TQTTQTILED LSQIKDKLYR DLEQKLELTT EMTAEYKRMC       180
     FSLSILAFLL IATTIILFHR SKPILENKTN TYRP                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page