(data stored in ACNUC7421 zone)

EMBL: CP001022.PE542

CP001022.PE542       Location/Qualifiers
FT   CDS             join(583923..584567,584567..585484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Exig_0549"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   cpr:CPR_2608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60030"
FT                   /db_xref="GOA:B1YJK0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK0"
FT                   /protein_id="ACB60030.1"
FT                   /translation="MSKSKFSPDEKLRIIRMCEDRMDSIKSIASLFELSVTTLNRWRAK
FT                   YRTYGSSSLRDRTEWTGYPEELKMEAVRAVLTQEESLTSATVRFNISSLSVLARWIRKY
FT                   TSHNTQGKPLKERSIMTKGRTTTFEERVQAVMDCIQNGKDYQNIMKTHRVSYQQIYSWV
FT                   RKFEKDGMDALMDRRGRQKPVAELTDTERFALELKRLEKENERLRMENDFLKKVRGDRE
FT                   EVTLSQIRLQDKYEAIQSSVEQFGYPIIALCHLADVSRAAYYKWLRRIGIPKAHEAENM
FT                   KIIEEMNQIHLSVKGIYGYRRMKLNLKRRFGRNVNAKRVRRLMHIASIHCVIRRKRPSY
FT                   IRNRPQQIAENILNRDFNAAGPNQKWVTDVTELKYGSSQKAYLSAILDLYDGSIRAFVL
FT                   GHSNNNQLVFDTFELALQGASGSRPLLHSDRGFQYTSHAFRHMTRVAGITQSMSWVGKC
FT                   IDNGPMESFWDALKCESYYLHKFAEFDELQLAIQKYIHFYNEERYQQRLNGLAPLEYRV
FT                   QAV"
     MSKSKFSPDE KLRIIRMCED RMDSIKSIAS LFELSVTTLN RWRAKYRTYG SSSLRDRTEW        60
     TGYPEELKME AVRAVLTQEE SLTSATVRFN ISSLSVLARW IRKYTSHNTQ GKPLKERSIM       120
     TKGRTTTFEE RVQAVMDCIQ NGKDYQNIMK THRVSYQQIY SWVRKFEKDG MDALMDRRGR       180
     QKPVAELTDT ERFALELKRL EKENERLRME NDFLKKVRGD REEVTLSQIR LQDKYEAIQS       240
     SVEQFGYPII ALCHLADVSR AAYYKWLRRI GIPKAHEAEN MKIIEEMNQI HLSVKGIYGY       300
     RRMKLNLKRR FGRNVNAKRV RRLMHIASIH CVIRRKRPSY IRNRPQQIAE NILNRDFNAA       360
     GPNQKWVTDV TELKYGSSQK AYLSAILDLY DGSIRAFVLG HSNNNQLVFD TFELALQGAS       420
     GSRPLLHSDR GFQYTSHAFR HMTRVAGITQ SMSWVGKCID NGPMESFWDA LKCESYYLHK       480
     FAEFDELQLA IQKYIHFYNE ERYQQRLNGL APLEYRVQAV                             520
//

If you have problems or comments...

PBIL Back to PBIL home page