(data stored in ACNUC7421 zone)

EMBL: CP001022.PE545

CP001022.PE545       Location/Qualifiers
FT   CDS             complement(587404..588318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0552"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: bcl:ABC3971
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM: FAD
FT                   linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60033"
FT                   /db_xref="GOA:B1YJK3"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJK3"
FT                   /protein_id="ACB60033.1"
FT                   /translation="MMTEQLLAGLYEGIAKEAVLINEPLKNHTYTKMGGLADLFLIPST
FT                   YEETAFAVRYAYEHDLPLTMLGNGSNLVVRDGGIRGIVLSFEKLTDISVEGHELIAQSG
FT                   AAIIQASRIAYDHALSGLEFACGIPGTIGGALIMNAGAYGGEVKDCLHSATVLTRKGEL
FT                   LNISHEELELGYRTSCFSKKEYIILEGRFSLTEGDPALIKEMMDDLTHKRETKQPLEYP
FT                   SCGSVFKRPEGYFAGKLIQDSGLQGARIGGAEVSQKHAGFIVNIKDATATDYISLIRHV
FT                   QETVQEKFGILLEPEVKIIGEEA"
     MMTEQLLAGL YEGIAKEAVL INEPLKNHTY TKMGGLADLF LIPSTYEETA FAVRYAYEHD        60
     LPLTMLGNGS NLVVRDGGIR GIVLSFEKLT DISVEGHELI AQSGAAIIQA SRIAYDHALS       120
     GLEFACGIPG TIGGALIMNA GAYGGEVKDC LHSATVLTRK GELLNISHEE LELGYRTSCF       180
     SKKEYIILEG RFSLTEGDPA LIKEMMDDLT HKRETKQPLE YPSCGSVFKR PEGYFAGKLI       240
     QDSGLQGARI GGAEVSQKHA GFIVNIKDAT ATDYISLIRH VQETVQEKFG ILLEPEVKII       300
     GEEA                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page