(data stored in ACNUC7421 zone)

EMBL: CP001022.PE55

CP001022.PE55        Location/Qualifiers
FT   CDS             73878..74825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0056"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: bpu:BPUM_0057 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59543"
FT                   /db_xref="GOA:B1YGR0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR0"
FT                   /protein_id="ACB59543.1"
FT                   /translation="MRIANSVLDLVGRTPIVKLNHLTGPEDADVYLKLEYMNPGSSVKD
FT                   RIALAMIESAESAGHLKAGDTIIEPTSGNTGIGLAMVAAAKGYRSILVMPETMSMERRT
FT                   LLRAYGAELILTAGPEGMKGAIARATAEAEEHGYFMPQQFNNESNPVVHEKTTGPEIVE
FT                   AFEGLTLDAFIAGIGTGGTITGAGKVLREAFPGIEIIAVEPTDSPVLSGGKPGPHKLQG
FT                   IGAGFVPSILDTQIYDSVEQVTTEEAFDHARRAAKSNGVLGGISSGAAIAAALKTAKRL
FT                   GKGKTVLAIIPSNGERYLSTPLYQVEEETDSSKL"
     MRIANSVLDL VGRTPIVKLN HLTGPEDADV YLKLEYMNPG SSVKDRIALA MIESAESAGH        60
     LKAGDTIIEP TSGNTGIGLA MVAAAKGYRS ILVMPETMSM ERRTLLRAYG AELILTAGPE       120
     GMKGAIARAT AEAEEHGYFM PQQFNNESNP VVHEKTTGPE IVEAFEGLTL DAFIAGIGTG       180
     GTITGAGKVL REAFPGIEII AVEPTDSPVL SGGKPGPHKL QGIGAGFVPS ILDTQIYDSV       240
     EQVTTEEAFD HARRAAKSNG VLGGISSGAA IAAALKTAKR LGKGKTVLAI IPSNGERYLS       300
     TPLYQVEEET DSSKL                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page