(data stored in ACNUC7421 zone)

EMBL: CP001022.PE555

CP001022.PE555       Location/Qualifiers
FT   CDS             595487..596197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0562"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; KEGG: bpu:BPUM_1854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60043"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL3"
FT                   /protein_id="ACB60043.1"
FT                   /translation="MKVLVVGASGTIGARVVKSLAKGHQVTVIVRHQHLVERFEKLGVK
FT                   AHYVDIETELEKVIEQGVSGQDAVICAATAGVDGEPTEIELLDRTVALKTIDAAKKARV
FT                   RHFVLLSAYGADRPNQFKKEMYPFYAAKNAAEEQIEHSGLTYTIICPVNIVDGEGRGLI
FT                   EADEDLKDVKEATISETDVASILVAAVDNRALFNRRLEVKEGKTTLNEALGGDEAVGSV
FT                   KDNRQVKKQLPRYN"
     MKVLVVGASG TIGARVVKSL AKGHQVTVIV RHQHLVERFE KLGVKAHYVD IETELEKVIE        60
     QGVSGQDAVI CAATAGVDGE PTEIELLDRT VALKTIDAAK KARVRHFVLL SAYGADRPNQ       120
     FKKEMYPFYA AKNAAEEQIE HSGLTYTIIC PVNIVDGEGR GLIEADEDLK DVKEATISET       180
     DVASILVAAV DNRALFNRRL EVKEGKTTLN EALGGDEAVG SVKDNRQVKK QLPRYN           236
//

If you have problems or comments...

PBIL Back to PBIL home page