(data stored in ACNUC7421 zone)

EMBL: CP001022.PE557

CP001022.PE557       Location/Qualifiers
FT   CDS             596925..597374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60045"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL5"
FT                   /protein_id="ACB60045.1"
FT                   /translation="MELYCAVCTYRQIIEIGQQEEWKGFPSVLTYGMESYASALPFLFV
FT                   PPYQEPLVSRQKIDDRIRAELIRTYHAHIEEIEDGWVPHQYDVFQCPTCQQISTRFWCA
FT                   LFLKGAIIEPVHRCEQDNSVLVRLSLDELTQTPCPSCAEQTLQIR"
     MELYCAVCTY RQIIEIGQQE EWKGFPSVLT YGMESYASAL PFLFVPPYQE PLVSRQKIDD        60
     RIRAELIRTY HAHIEEIEDG WVPHQYDVFQ CPTCQQISTR FWCALFLKGA IIEPVHRCEQ       120
     DNSVLVRLSL DELTQTPCPS CAEQTLQIR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page