(data stored in ACNUC7421 zone)

EMBL: CP001022.PE56

CP001022.PE56        Location/Qualifiers
FT   CDS             74963..76351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0057"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Anthranilate synthase component I domain
FT                   protein; Chorismate binding-like; KEGG: bca:BCE_0067
FT                   para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59544"
FT                   /db_xref="GOA:B1YGR1"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR1"
FT                   /protein_id="ACB59544.1"
FT                   /translation="MRQTVYESFTWTKEQFYNRYVERTAGQTGHIWLESGRIGSYTMAG
FT                   VRPVGHIRTKNGRTIIQEAGQEKQYTDAPFTLLEEIRARYASARPEGMPPFFGGLAGYV
FT                   SYDAVRYLERLPEQAEDDLATADLSLYWYDEVAVFDHQTERLFIAVTRETEAEATLALA
FT                   AEVSSWRQSSPAPMFAAPEEKTAERGRSFERSAFMQAADRIKQYIEAGDVFQVNLAVRQ
FT                   QEPLRTTPAHIYDVLRTINPSPYMGYFADKELVLVSASPELLVEKIGLSLATRPIAGTR
FT                   PRGQNEEEDLALAKTLLDNEKERAEHVMLVDLERNDLGRVSRYGSVHVDELMVIEKYSH
FT                   VQHIVSNVRGEIAADETGSSVLAAMFPGGTITGAPKIRTMEIIEELEPVRRGIYTGALG
FT                   FISWADDVIFNILIRTLVAKDGMAYIQAGAGIVTDSDSESEYEESLSKAKALWVAKEMA
FT                   EGTT"
     MRQTVYESFT WTKEQFYNRY VERTAGQTGH IWLESGRIGS YTMAGVRPVG HIRTKNGRTI        60
     IQEAGQEKQY TDAPFTLLEE IRARYASARP EGMPPFFGGL AGYVSYDAVR YLERLPEQAE       120
     DDLATADLSL YWYDEVAVFD HQTERLFIAV TRETEAEATL ALAAEVSSWR QSSPAPMFAA       180
     PEEKTAERGR SFERSAFMQA ADRIKQYIEA GDVFQVNLAV RQQEPLRTTP AHIYDVLRTI       240
     NPSPYMGYFA DKELVLVSAS PELLVEKIGL SLATRPIAGT RPRGQNEEED LALAKTLLDN       300
     EKERAEHVML VDLERNDLGR VSRYGSVHVD ELMVIEKYSH VQHIVSNVRG EIAADETGSS       360
     VLAAMFPGGT ITGAPKIRTM EIIEELEPVR RGIYTGALGF ISWADDVIFN ILIRTLVAKD       420
     GMAYIQAGAG IVTDSDSESE YEESLSKAKA LWVAKEMAEG TT                          462
//

If you have problems or comments...

PBIL Back to PBIL home page