(data stored in ACNUC7421 zone)

EMBL: CP001022.PE560

CP001022.PE560       Location/Qualifiers
FT   CDS             599548..599643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60048"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL8"
FT                   /protein_id="ACB60048.1"
FT                   /translation="MFTAIFVVVIALMGASVYGIDHMVAQRAEKR"
     MFTAIFVVVI ALMGASVYGI DHMVAQRAEK R                                       31
//

If you have problems or comments...

PBIL Back to PBIL home page