(data stored in ACNUC7421 zone)

EMBL: CP001022.PE563

CP001022.PE563       Location/Qualifiers
FT   CDS             602065..602838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0570"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: gtn:GTNG_0672 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60051"
FT                   /db_xref="GOA:B1YJM1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM1"
FT                   /protein_id="ACB60051.1"
FT                   /translation="MTKRKLIKLGGSVFEQLDPRYYEEWGQWLAEKNELIILHGGGPAL
FT                   SAYCRDMNIKAEFNNGIRVTTEQVLLGAERVLGGEVQSKIVYELNENGLPAIGLTGIDG
FT                   ASIRGEQQPAFGAVGEVTQINPKLFTTLMASGFLPVVTSLITGTEGTLNCNGDTCAIAV
FT                   AKGLAVDEFELLTDVSGVRLNGTFQSEVTVAELEEGIESTEINGGMIPKVEAVIEAVRQ
FT                   GIHQVKIRSGHDVTSQGTRIKEETNERFTTDVFTS"
     MTKRKLIKLG GSVFEQLDPR YYEEWGQWLA EKNELIILHG GGPALSAYCR DMNIKAEFNN        60
     GIRVTTEQVL LGAERVLGGE VQSKIVYELN ENGLPAIGLT GIDGASIRGE QQPAFGAVGE       120
     VTQINPKLFT TLMASGFLPV VTSLITGTEG TLNCNGDTCA IAVAKGLAVD EFELLTDVSG       180
     VRLNGTFQSE VTVAELEEGI ESTEINGGMI PKVEAVIEAV RQGIHQVKIR SGHDVTSQGT       240
     RIKEETNERF TTDVFTS                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page