(data stored in ACNUC7421 zone)

EMBL: CP001022.PE566

CP001022.PE566       Location/Qualifiers
FT   CDS             604985..608017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0573"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein ATP-grasp; protein of unknown function
FT                   DUF201; Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain oligomerisation;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: gtn:GTNG_0675 carbamoylphosphate synthetase heavy
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60054"
FT                   /db_xref="GOA:B1YJM4"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM4"
FT                   /protein_id="ACB60054.1"
FT                   /translation="MQEVKKVLVIGSGPIVIGQAAEFDYSGTQACQTLREAGCEVMLMN
FT                   SNPATIMTDPSTADHIYIEAMTLEKATAIIKRERPTHLLATVGGQTALNLALSLEEAGV
FT                   LDQYQVKLLGTSLETIRDGEDRERFKQRMLELDQPLPISQTIETLEELEGFMEKAGVPL
FT                   VVRPAFTLGGTGGGIAQTKEEARKLAANGLQASPISQCLVEASIAGYKEVEYEVMRDAF
FT                   DTTIIVCNMENIDPVGVHTGDSVVFAPIQSISDKMNQILRTASREIVSALGVVGGCNIQ
FT                   FAIHPTEQTYYVIEVNPRVSRSSALASKATGYPIAKLATRLALGERLDDCINPVTKETM
FT                   ASFEPVLDYVTAKVPCFPFDLFPGSDRSLGTQMKATGESMAMGKTLEEALQKAWRGAGI
FT                   EQAPLYPNWMKQADTEVLWQEVNQITDRRLLAMLALLDRKAATHEELAEKTQIQSLFLT
FT                   TLETLILMQESLDLESKESLQQAKGFGFTDQQIAQITDVPLEVVQQQRNTFLIQPSFQM
FT                   IDTCGAEFSSLTPYFYGSWSGRTEVTPSSRKKVAVLGAGPIRIGQGIEFDYCSVHAVRA
FT                   LQKAGYETIMINNNPETVSTDFEVADRLYVEPLTIEDVVHVLEAEQCRQVLVQFGGQTA
FT                   ITLAAELEELGYQLLGTTADTIDEMEDRDRFYQFLDRLQIDRILGQEVSNEEELTAIVK
FT                   ELGYPLMIRPSYVIGGKGMHRLTTATDLEKLLPEMVFPILVDAYIEGHEFEVDCISDKT
FT                   TTYVPVIMEQIEAAGVHSGDSTMILPPVSALASLQDEIEQIAQTIGQHLDYQGAFNIQF
FT                   VVKDQTVYVLEINPRASRTLPIVSKVTGQPLLEWAVQAAIGMKVEALPANRLTLPFHAV
FT                   KTPVFSTLKLRGVDPMTGPVMRSTGETLQWTEAGLAKERFVFDQTTKTAMAKRTLRICG
FT                   AGTDAWSEGAAVQPDTEFDTCLVFFSKSESEREQREKALAQGAIVITEEHLAQYFESVQ
FT                   TIPMCTVKPLSEWTTQKERIQ"
     MQEVKKVLVI GSGPIVIGQA AEFDYSGTQA CQTLREAGCE VMLMNSNPAT IMTDPSTADH        60
     IYIEAMTLEK ATAIIKRERP THLLATVGGQ TALNLALSLE EAGVLDQYQV KLLGTSLETI       120
     RDGEDRERFK QRMLELDQPL PISQTIETLE ELEGFMEKAG VPLVVRPAFT LGGTGGGIAQ       180
     TKEEARKLAA NGLQASPISQ CLVEASIAGY KEVEYEVMRD AFDTTIIVCN MENIDPVGVH       240
     TGDSVVFAPI QSISDKMNQI LRTASREIVS ALGVVGGCNI QFAIHPTEQT YYVIEVNPRV       300
     SRSSALASKA TGYPIAKLAT RLALGERLDD CINPVTKETM ASFEPVLDYV TAKVPCFPFD       360
     LFPGSDRSLG TQMKATGESM AMGKTLEEAL QKAWRGAGIE QAPLYPNWMK QADTEVLWQE       420
     VNQITDRRLL AMLALLDRKA ATHEELAEKT QIQSLFLTTL ETLILMQESL DLESKESLQQ       480
     AKGFGFTDQQ IAQITDVPLE VVQQQRNTFL IQPSFQMIDT CGAEFSSLTP YFYGSWSGRT       540
     EVTPSSRKKV AVLGAGPIRI GQGIEFDYCS VHAVRALQKA GYETIMINNN PETVSTDFEV       600
     ADRLYVEPLT IEDVVHVLEA EQCRQVLVQF GGQTAITLAA ELEELGYQLL GTTADTIDEM       660
     EDRDRFYQFL DRLQIDRILG QEVSNEEELT AIVKELGYPL MIRPSYVIGG KGMHRLTTAT       720
     DLEKLLPEMV FPILVDAYIE GHEFEVDCIS DKTTTYVPVI MEQIEAAGVH SGDSTMILPP       780
     VSALASLQDE IEQIAQTIGQ HLDYQGAFNI QFVVKDQTVY VLEINPRASR TLPIVSKVTG       840
     QPLLEWAVQA AIGMKVEALP ANRLTLPFHA VKTPVFSTLK LRGVDPMTGP VMRSTGETLQ       900
     WTEAGLAKER FVFDQTTKTA MAKRTLRICG AGTDAWSEGA AVQPDTEFDT CLVFFSKSES       960
     EREQREKALA QGAIVITEEH LAQYFESVQT IPMCTVKPLS EWTTQKERIQ                 1010
//

If you have problems or comments...

PBIL Back to PBIL home page