(data stored in ACNUC7421 zone)

EMBL: CP001022.PE568

CP001022.PE568       Location/Qualifiers
FT   CDS             complement(609005..609814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0575"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   oih:OB0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60056"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM6"
FT                   /protein_id="ACB60056.1"
FT                   /translation="MIQMKMPGVMVYQSTLMKTTSTLIETPDCLIVVDPGWLPDEIATI
FT                   RRDVEIIRHDRPLYIVYTHAHFDHILGAYAFKDAIAIASRRFVDVDRTAALEEVQNFND
FT                   EYYIESPVLFPDITHVIEESETTLTIGKTKLIFFLTPGHESTHLSFVVMPLHLLVCGDY
FT                   ASDVEIPLIEHDSSEYLTTLELLESFIYEYEVKLLIPGHGHICDVRTEMIERLHLSYDY
FT                   ILALRAHKESDWSPSWQRTSFMGRLHEKNKRQITKEQTEQLARRQYD"
     MIQMKMPGVM VYQSTLMKTT STLIETPDCL IVVDPGWLPD EIATIRRDVE IIRHDRPLYI        60
     VYTHAHFDHI LGAYAFKDAI AIASRRFVDV DRTAALEEVQ NFNDEYYIES PVLFPDITHV       120
     IEESETTLTI GKTKLIFFLT PGHESTHLSF VVMPLHLLVC GDYASDVEIP LIEHDSSEYL       180
     TTLELLESFI YEYEVKLLIP GHGHICDVRT EMIERLHLSY DYILALRAHK ESDWSPSWQR       240
     TSFMGRLHEK NKRQITKEQT EQLARRQYD                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page