(data stored in ACNUC7421 zone)

EMBL: CP001022.PE569

CP001022.PE569       Location/Qualifiers
FT   CDS             610264..610776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60057"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM7"
FT                   /protein_id="ACB60057.1"
FT                   /translation="MGKGWMATCHHQIDRYRFTTGEWFLNASLLAFSIEQDADMLPDVL
FT                   PNELKIPLVSERMKQILERLTPFSVQCLRVQLKTRTGLINYYLINILAVRRVEHLHKTE
FT                   IFRTLRKKQVYFMTERIVSTSLGPHHILRDERTERIFLSDTLARCFQQLAVTGIHFDEI
FT                   NRMEEII"
     MGKGWMATCH HQIDRYRFTT GEWFLNASLL AFSIEQDADM LPDVLPNELK IPLVSERMKQ        60
     ILERLTPFSV QCLRVQLKTR TGLINYYLIN ILAVRRVEHL HKTEIFRTLR KKQVYFMTER       120
     IVSTSLGPHH ILRDERTERI FLSDTLARCF QQLAVTGIHF DEINRMEEII                  170
//

If you have problems or comments...

PBIL Back to PBIL home page