(data stored in ACNUC7421 zone)

EMBL: CP001022.PE570

CP001022.PE570       Location/Qualifiers
FT   CDS             610773..611192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60058"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM8"
FT                   /protein_id="ACB60058.1"
FT                   /translation="MKQYTVDNWITLQYPKTFEYQEEETFVSFYSTEENAMGTLQLSIY
FT                   ESDTEELTPFEAAEQEINLLVEEFGIELTGPLEARRNSSKEALLAVDGKEEEVFIRIYA
FT                   YSDGERLVLLTYSADRESLELEEIEAMILSLNWIH"
     MKQYTVDNWI TLQYPKTFEY QEEETFVSFY STEENAMGTL QLSIYESDTE ELTPFEAAEQ        60
     EINLLVEEFG IELTGPLEAR RNSSKEALLA VDGKEEEVFI RIYAYSDGER LVLLTYSADR       120
     ESLELEEIEA MILSLNWIH                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page