(data stored in ACNUC7421 zone)

EMBL: CP001022.PE573

CP001022.PE573       Location/Qualifiers
FT   CDS             614068..614958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0580"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB2569 multiple
FT                   sugar-binding transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60061"
FT                   /db_xref="GOA:B1YJN1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN1"
FT                   /protein_id="ACB60061.1"
FT                   /translation="MAVSNKKKVKRGLEFWMFVGPVFLVFAVIVLVPFFNGVMYSFTDW
FT                   NGITGELNWIGFDNYVRLFTVDEQFQQSFWLTTKYTVVAVVLTNLVGFILAFLLTQNIR
FT                   TRNFLRTIFFMPNLIGGLILGFVWQFIYVKGFASIGELTGWSLFELPWLGDARTGFWGI
FT                   VIVSIWQGGGYIMVIYIAALQNVPQELIEAAKIDGANRLSTLRNITIPLIMPSVTICLF
FT                   LTISWSFKLFDTNLSLTNGGPFKSTEMLALNIYKESFTNNNLGLGSAKAIIFFVVVAAI
FT                   TVTQVYLTKKREVEA"
     MAVSNKKKVK RGLEFWMFVG PVFLVFAVIV LVPFFNGVMY SFTDWNGITG ELNWIGFDNY        60
     VRLFTVDEQF QQSFWLTTKY TVVAVVLTNL VGFILAFLLT QNIRTRNFLR TIFFMPNLIG       120
     GLILGFVWQF IYVKGFASIG ELTGWSLFEL PWLGDARTGF WGIVIVSIWQ GGGYIMVIYI       180
     AALQNVPQEL IEAAKIDGAN RLSTLRNITI PLIMPSVTIC LFLTISWSFK LFDTNLSLTN       240
     GGPFKSTEML ALNIYKESFT NNNLGLGSAK AIIFFVVVAA ITVTQVYLTK KREVEA           296
//

If you have problems or comments...

PBIL Back to PBIL home page