(data stored in ACNUC7421 zone)

EMBL: CP001022.PE574

CP001022.PE574       Location/Qualifiers
FT   CDS             614955..615842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0581"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cno:NT01CX_0967 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60062"
FT                   /db_xref="GOA:B1YJN2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN2"
FT                   /protein_id="ACB60062.1"
FT                   /translation="MSTAQPLPKPELKPEQPAPKKRGRYSVRLGTVEIAALLMGLLYMI
FT                   PFYYVISNSFKTQGDIFTNTSGLPKEWITENYTNAWEAMNFGKVFLNSVIITVGANAVI
FT                   VIFCSMAAWKLVRTKSRLSTIIFFLFVAAMIIPFQSIMIPLSKLSGDLGLQNSYWGLIL
FT                   MYLGFGSGLSIFLYHGFMKSIPEEIEEAAIIDGCSQWGVFWRIVFPLLKPITVTIVILN
FT                   TLWIWNDFLLPSLMLRDVELRTIPLATFYFFGQYTKQWDLALAGLILGIIPLLLFFFAM
FT                   QKQIIQGITSGSIK"
     MSTAQPLPKP ELKPEQPAPK KRGRYSVRLG TVEIAALLMG LLYMIPFYYV ISNSFKTQGD        60
     IFTNTSGLPK EWITENYTNA WEAMNFGKVF LNSVIITVGA NAVIVIFCSM AAWKLVRTKS       120
     RLSTIIFFLF VAAMIIPFQS IMIPLSKLSG DLGLQNSYWG LILMYLGFGS GLSIFLYHGF       180
     MKSIPEEIEE AAIIDGCSQW GVFWRIVFPL LKPITVTIVI LNTLWIWNDF LLPSLMLRDV       240
     ELRTIPLATF YFFGQYTKQW DLALAGLILG IIPLLLFFFA MQKQIIQGIT SGSIK            295
//

If you have problems or comments...

PBIL Back to PBIL home page