(data stored in ACNUC7421 zone)

EMBL: CP001022.PE582

CP001022.PE582       Location/Qualifiers
FT   CDS             624585..625289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0589"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: bcl:ABC3587
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60070"
FT                   /db_xref="GOA:B1YJP0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP0"
FT                   /protein_id="ACB60070.1"
FT                   /translation="MNVLIVDDEKHVRDAVKLLGEWDTWQIGNIFEADDGVTAKRFLEQ
FT                   EKIDLMLTDVEMPGLDGLSLLEWTKNHHPKVVTIVLTGYDDYTYMRRAILHQSFDYLLK
FT                   PIDPDILNDALGRAMELIGPVQEQGEAIDQIAKYISTHYAEELTLQLMSERFYLSREYI
FT                   SRRFKQRFSVNLSDYIQTIRLNRAKELLGETDARIYEIALEVGYHDDKYFRKVFKKQFG
FT                   MTPNEFRELLSV"
     MNVLIVDDEK HVRDAVKLLG EWDTWQIGNI FEADDGVTAK RFLEQEKIDL MLTDVEMPGL        60
     DGLSLLEWTK NHHPKVVTIV LTGYDDYTYM RRAILHQSFD YLLKPIDPDI LNDALGRAME       120
     LIGPVQEQGE AIDQIAKYIS THYAEELTLQ LMSERFYLSR EYISRRFKQR FSVNLSDYIQ       180
     TIRLNRAKEL LGETDARIYE IALEVGYHDD KYFRKVFKKQ FGMTPNEFRE LLSV             234
//

If you have problems or comments...

PBIL Back to PBIL home page