(data stored in ACNUC7421 zone)

EMBL: CP001022.PE586

CP001022.PE586       Location/Qualifiers
FT   CDS             628793..629182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0593"
FT                   /product="glycerol-3-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="KEGG: bcl:ABC3101 glycerol-3-phosphate
FT                   cytidylyltransferase; TIGRFAM: cytidyltransferase-related
FT                   domain protein; glycerol-3-phosphate cytidylyltransferase;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60074"
FT                   /db_xref="GOA:B1YJP4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP4"
FT                   /protein_id="ACB60074.1"
FT                   /translation="MKKVITYGTFDLLHWGHINILKRAKEMGDYLVVAISTDEFNRLKH
FT                   KESYHSFENRKLILESIRYVDEVIAENNWDQKITDVQEHQIDTFVMGDDWAGEFDFLKE
FT                   YCEVVYLSRTEGISTSQIKTELGKG"
     MKKVITYGTF DLLHWGHINI LKRAKEMGDY LVVAISTDEF NRLKHKESYH SFENRKLILE        60
     SIRYVDEVIA ENNWDQKITD VQEHQIDTFV MGDDWAGEFD FLKEYCEVVY LSRTEGISTS       120
     QIKTELGKG                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page