(data stored in ACNUC7421 zone)

EMBL: CP001022.PE589

CP001022.PE589       Location/Qualifiers
FT   CDS             631568..631681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60077"
FT                   /db_xref="GOA:B1YJP7"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP7"
FT                   /protein_id="ACB60077.1"
FT                   /translation="MSSKPEPNLSGTIVAVFIVASVIIGMWGSIFLLFSSR"
     MSSKPEPNLS GTIVAVFIVA SVIIGMWGSI FLLFSSR                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page