(data stored in ACNUC7421 zone)

EMBL: CP001022.PE67

CP001022.PE67        Location/Qualifiers
FT   CDS             94970..97417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0068"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: bha:BH0103 class III stress
FT                   response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59555"
FT                   /db_xref="GOA:B1YGS2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS2"
FT                   /protein_id="ACB59555.1"
FT                   /translation="MMFGRFTERAQRVLALAQEEAVRLGHHNIGTEHILLGLVREGDGI
FT                   AAKALTALGLSSDKIQMEVEALIGRGQDGATTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHLLLGLIREGEGVAARVLNNLGISLSKARQQVLQLLGNSETTANASQAGSGVATPTL
FT                   DGLARDLTQQARETRLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAVVEGLA
FT                   QQIINNEVPETLRNKRVMVLDMGTLVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVA
FT                   EPTTDEATQILFGLRDRYEAHHRVTITDEAIQEAVTLSDRYISDRFLPDKAIDLIDEAA
FT                   SKVRLRSYTAPPNLKEVEAKLEGIRKDKDEAVQSQEFEKAASLRDTEQKLRDELERLKE
FT                   EWQNKQGNEKLEVTKDDIAQVVANWTGVPVTKIAEEETDRLLRLEEILHGRVIGQNEAV
FT                   KSISKAIRRARAGLKDPKRPIGSFIFLGPTGVGKTELARAVAEAMFGDEDAIIRIDMSE
FT                   YMEKHATSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVILLDEIEKAHPEVFNILLQVLD
FT                   DGRLTDSKGRTVDFRNTIIVMTSNVGASALKRNKYVGFAVSDDTDREYKDMKGKVMEEL
FT                   KRAFRPEFLNRIDETIVFHSLEKKHIEEIVKLMAKTLEKRLAEQQVHFELTPAALSKIA
FT                   DIGYDPEYGARPIRRALQREAEDRLSEALLAGDIQKGERVALDVEDGEFIVRRHQAEPA
FT                   TTE"
     MMFGRFTERA QRVLALAQEE AVRLGHHNIG TEHILLGLVR EGDGIAAKAL TALGLSSDKI        60
     QMEVEALIGR GQDGATTIHY TPRAKKVIEL SMDEARKLGH SYVGTEHLLL GLIREGEGVA       120
     ARVLNNLGIS LSKARQQVLQ LLGNSETTAN ASQAGSGVAT PTLDGLARDL TQQARETRLD       180
     PVIGRSKEIQ RVIEVLSRRT KNNPVLIGEP GVGKTAVVEG LAQQIINNEV PETLRNKRVM       240
     VLDMGTLVAG TKYRGEFEDR LKKVMDEIRQ AGNIILFIDE LHTLIGAGGA EGAIDASNIL       300
     KPSLARGELQ CIGATTLDEY RKYIEKDAAL ERRFQPIQVA EPTTDEATQI LFGLRDRYEA       360
     HHRVTITDEA IQEAVTLSDR YISDRFLPDK AIDLIDEAAS KVRLRSYTAP PNLKEVEAKL       420
     EGIRKDKDEA VQSQEFEKAA SLRDTEQKLR DELERLKEEW QNKQGNEKLE VTKDDIAQVV       480
     ANWTGVPVTK IAEEETDRLL RLEEILHGRV IGQNEAVKSI SKAIRRARAG LKDPKRPIGS       540
     FIFLGPTGVG KTELARAVAE AMFGDEDAII RIDMSEYMEK HATSRLVGSP PGYVGYEEGG       600
     QLTEKVRRKP YSVILLDEIE KAHPEVFNIL LQVLDDGRLT DSKGRTVDFR NTIIVMTSNV       660
     GASALKRNKY VGFAVSDDTD REYKDMKGKV MEELKRAFRP EFLNRIDETI VFHSLEKKHI       720
     EEIVKLMAKT LEKRLAEQQV HFELTPAALS KIADIGYDPE YGARPIRRAL QREAEDRLSE       780
     ALLAGDIQKG ERVALDVEDG EFIVRRHQAE PATTE                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page