(data stored in ACNUC7421 zone)

EMBL: CP001022.PE69

CP001022.PE69        Location/Qualifiers
FT   CDS             99005..100093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0070"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein PINc; KEGG: oih:OB0095 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59557"
FT                   /db_xref="GOA:B1YGS4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS4"
FT                   /protein_id="ACB59557.1"
FT                   /translation="MKIVIRIFFALLGLALGILLLPQLFQLIEAATKMAFPEWLMTTYV
FT                   TGTIGALIFLLIGLFITDSVIRLLRFLEEKLVKAPVADLFFGTFGLLVGLVMAFLVSML
FT                   IELVGIPLLSNVLTVIVAVLFGYLGFTVGYRKRHELTKVFLRNSNNQSEKKAAEPVVVA
FT                   KSNSKVLDTSVIIDGRITDIAKTGFVEGKLIVPQFVIGELQYIADSSDTLKRNRGRRGL
FT                   DVLKELQSIPGMEVEIYDGDFEDVPEVDIKLIKLAELMKGIVVTNDYNLNKVCEVRNVP
FT                   VLNINDLANAVKQVVIPGEEMTVLVIKEGKEQKQGIAYLEDGTMVVVEEGKHLISKTVG
FT                   VVVTSVLQTSAGRMIFAKPQEK"
     MKIVIRIFFA LLGLALGILL LPQLFQLIEA ATKMAFPEWL MTTYVTGTIG ALIFLLIGLF        60
     ITDSVIRLLR FLEEKLVKAP VADLFFGTFG LLVGLVMAFL VSMLIELVGI PLLSNVLTVI       120
     VAVLFGYLGF TVGYRKRHEL TKVFLRNSNN QSEKKAAEPV VVAKSNSKVL DTSVIIDGRI       180
     TDIAKTGFVE GKLIVPQFVI GELQYIADSS DTLKRNRGRR GLDVLKELQS IPGMEVEIYD       240
     GDFEDVPEVD IKLIKLAELM KGIVVTNDYN LNKVCEVRNV PVLNINDLAN AVKQVVIPGE       300
     EMTVLVIKEG KEQKQGIAYL EDGTMVVVEE GKHLISKTVG VVVTSVLQTS AGRMIFAKPQ       360
     EK                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page